The details of FoldDB ID: fd0210 |
|---|
Use the buttons at the bottom of Jsmol viewer to see different representations, ON/OFF Hydrogens, and ON/OFF rotation.
3D model is for representation purpose only. To access the experimental 3D structure kindly go to the browse structure tab and look for PDB or CCDC id.
.
.
| Identification | |
|---|---|
| FoldDB ID | fd0210 |
| One Letter code
Since there is no uniform representation for the non-natural peptides. The one letter code reported here is as it is mentioned in the original article and/or the external database. | DTYKLILNGXGLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDXGTFTVTEX |
| Three Letter code
Since there is no uniform representation for the non-natural peptides. The three letter code reported here is as it is mentioned in the original article and/or the external database. | ASP THR TYR LYS LEU ILE LEU ASN GLY AIB GLY LEU LYS GLY GLU THR THR THR GLU ALA VAL ASP ALA ALA THR ALA GLU LYS VAL PHE LYS GLN TYR ALA ASN ASP ASN GLY VAL ASP GLY GLU TRP THR TYR ASP DPR GLY THR PHE THR VAL THR GLU NH2 |
| Length | 55 |
| Source | Streptococcus sp. 'group G' |
| External ID | |||||
|---|---|---|---|---|---|
| NCBI Accession | |||||
| Other information | |
|---|---|
| Foldamer type | α/β Peptide |
| Activity |
|---|
| Activity not reported |
| Citations | |||||
|---|---|---|---|---|---|
| ID | Title | Year | Authors | Journal | DOI |
Protein-Like Tertiary Folding Behavior from Heterogeneous Backbones | 2013 | Zachary E. Reinert, George A. Lengyel, Horne, W. Seth | Journal of the American Chemical Society | ||
