The details of FoldDB ID: fd0404 |
---|
3D model is for representation purpose only. To access the experimental 3D structure kindly go to the browse structure tab and look for PDB or CCDC id.
.
.
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
FoldDB ID | fd0404 | ||||||||
One Letter code ![]() | ANIKLSVQMKLFKRHLKWKIIVKLNDGRELSLDG-NH2 | ||||||||
Source | synthetic construct |
Structural Information | |
---|---|
Structure reported | yes |
Method | NMR |
NMR Solvent | d18-HEPES buffer (90% H2O, 10% D2O) |
Other information | |
---|---|
Application | antiproliferative agent |
Foldamer type | α/β Peptide |
Structure Type | beta sheet |
Activity |
---|
Activity ID | Assay name | Cell line | Target Protein | Organism | Assay Category | Value | Unit | Type | Measurement object |
---|---|---|---|---|---|---|---|---|---|
fdact0130 | qualitative | In Vivo (Animal models) |
| qualitative |
Citations | |||||
---|---|---|---|---|---|
ID | Title | Year | Authors | Journal | DOI |
Foldameric α/β-Peptide Analogs of the β-Sheet-Forming Antiangiogenic Anginex: Structure and Bioactivity | 2013 | Hegedüs, Zsófia., Wéber, Edit., Kriston-Pál, Éva., Makra, Ildikó., Czibula, Ágnes., Monostori, Éva., Martinek, Tamás A., | Journal of the American Chemical Society |